Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC10A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC10A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09551A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC10A2 |
| Target Synonyms | ASBT; IBAT; ISBT; PBAM; NTCP2; PBAM1; SLC10A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, Mouse small intestine, Rat liver, Rat small intestine | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPLIYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK | Uniprot ID | Q12908 |
Uniprot Id
Q12908
Target Species
Human
Target Name
SLC10A2
Target Full Name
Ileal sodium/bile acid cotransporter
Target Function
Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Plays a key role in cholesterol metabolism.
Target Involvement
Primary bile acid malabsorption (PBAM)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Bile acid:sodium symporter (BASS) (TC 2.A.28) family
Target Synonyms
Apical sodium dependent bile acid transporter; Apical sodium- dependent bile acid transporter; Apical sodium-dependent bile acid transporter; ASBT; IBAT; ileal; ileal apical sodium-dependent bile acid transporter; Ileal Na(+)/bile acid cotransporter; Ileal sodium dependent bile acid transporter; Ileal sodium-dependent bile acid transporter; Ileal sodium/bile acid cotransporter; ISBT; Na(+)-dependent ileal bile acid transporter; Na+ bile acid cotransporter; Na+ dependent ileal bile acid transporter; NTCP2; NTCP2_HUMAN; PBAM; SLC10A2; Sodium/taurocholate cotransporting polypeptide; Sodium/taurocholate cotransporting polypeptide; ileal; solute carrier family 10 (sodium/bile acid cotransporter family); Solute carrier family 10 (sodium/bile acid cotransporter family); member 2; Solute carrier family 10 member 2
Target Background
This gene encodes a sodium/bile acid cotransporter. This transporter is the primary mechanism for uptake of intestinal bile acids by apical cells in the distal ileum. Bile acids are the catabolic product of cholesterol metabolism, so this protein is also critical for cholesterol homeostasis. Mutations in this gene cause primary bile acid malabsorption (PBAM); muatations in this gene may also be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
