-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC12A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human SLC12A1 (NP_000329.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC12A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human SLC12A1 (NP_000329.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11151A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC12A1 |
| Target Synonyms | BSC; BSC1; CCC2; BSC-1; NKCC2; SLC12A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SLC12A1 (NP_000329.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSAD | Uniprot ID | Q13621 |
Uniprot Id
Q13621
Target Species
Human
Target Name
SLC12A1
Target Full Name
Solute carrier family 12 member 1
Target Function
Renal sodium, potassium and chloride ion cotransporter that mediates the transepithelial NaCl reabsorption in the thick ascending limb and plays an essential role in the urinary concentration and volume regulation. Electrically silent transporter system.
Target Involvement
Bartter syndrome 1, antenatal (BARTS1)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC12A transporter family
Target Tissue Specificity
Kidney; localizes to the thick ascending limbs (at protein level).
Target Synonyms
BSC1; Bumetanide sensitive sodium 3; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney specific Na K Cl symporter; Kidney-specific Na-K-Cl symporter; MGC48843; Na K 2Cl cotransporter; NKCC2; potassiumchloride cotransporter 2; S12A1_HUMAN; Slc12a1; sodium potassium chloride cotransporter 2; solute carrier family 12 (sodium/potassium/chloride transporters); Solute carrier family 12 member 1
Target Background
This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity in humans has not been experimentally proven.
Notification