-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC20A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC20A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11230A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC20A1 |
| Target Synonyms | PIT1; GLVR1; PiT-1; Glvr-1; SLC20A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, A-431, HT-1080, Mouse brain, Mouse liver, NCI-H460 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN | Uniprot ID | Q8WUM9 |
Uniprot Id
Q8WUM9
Target Species
Human
Target Name
SLC20A1
Target Full Name
Sodium-dependent phosphate transporter 1
Target Function
Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification.; (Microbial infection) May function as a retroviral receptor as it confers human cells susceptibility to infection to Gibbon Ape Leukemia Virus (GaLV), Simian sarcoma-associated virus (SSAV) and Feline leukemia virus subgroup B (FeLV-B) as well as 10A1 murine leukemia virus (10A1 MLV).
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Inorganic phosphate transporter (PiT) (TC 2.A.20) family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DKFZp686J2397; FLJ41426; Gibbon ape leukemia virus receptor 1; GLVR 1; GLVR-1; GLVR1; Leukemia virus receptor 1 homolog; Phosphate transporter 1; PIT 1; PiT-1; PIT1; S20A1_HUMAN; Slc20a1; Sodium dependent phosphate transporter 1; Sodium-dependent phosphate transporter 1; Solute carrier family 20 (phosphate transporter) member 1; Solute carrier family 20 member 1
Target Background
The protein encoded by this gene is a sodium-phosphate symporter that absorbs phosphate from interstitial fluid for use in cellular functions such as metabolism, signal transduction, and nucleic acid and lipid synthesis. The encoded protein is also a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus.
Notification