Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC22A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-142 of human SLC22A7 (NP_696961.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC22A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-142 of human SLC22A7 (NP_696961.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05252A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC22A7 |
| Target Synonyms | NLT; OAT2; hOAT11; SLC22A7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, Mouse liver, Rat kidney, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-142 of human SLC22A7 (NP_696961.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKG | Uniprot ID | Q9Y694 |
Uniprot Id
Q9Y694
Target Species
Human
Target Name
SLC22A7
Target Full Name
Solute carrier family 22 member 7
Target Function
Mediates sodium-independent multispecific organic anion transport. Transport of prostaglandin E2, prostaglandin F2, tetracycline, bumetanide, estrone sulfate, glutarate, dehydroepiandrosterone sulfate, allopurinol, 5-fluorouracil, paclitaxel, L-ascorbic acid, salicylate, ethotrexate, and alpha-ketoglutarate.
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein. Note=Apical side of the renal tubule.
Target Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Target Tissue Specificity
Expressed in liver and kidney.
Target Synonyms
hOAT2; liver specific transporter; NLT; Novel liver transporter; OAT2; Organic anion transporter 2; Organic anion transporter member 7; Organic anion transporter member 7 Fragment; S22A7_HUMAN; SLC22A7; solute carrier family 22 (organic anion transporter) member 7; Solute carrier family 22; Solute carrier family 22 member 7
Target Background
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
