Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC24A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human SLC24A5 (NP_995322.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against SLC24A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human SLC24A5 (NP_995322.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of Hela cells using SLC24A5 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-05204A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC24A5 |
| Target Synonyms | JSX; OCA6; NCKX5; SHEP4; SLC24A5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human SLC24A5 (NP_995322.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | INQYIIKKCSPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSISLHGLSQVSEDPPSVFNMPE | Uniprot ID | Q71RS6 |
Uniprot Id
Q71RS6
Target Species
Human
Target Name
SLC24A5
Target Full Name
Sodium/potassium/calcium exchanger 5
Target Function
Cation exchanger involved in pigmentation, possibly by participating in ion transport in melanosomes. Predominant sodium-Calcium exchanger in melanocytes. Probably transports 1 Ca(2+) and 1 K(+) to the melanosome in exchange for 4 cytoplasmic Na(+).
Target Involvement
Albinism, oculocutaneous, 6 (OCA6)
Target Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Melanosome. Note=Enriched in late-stage melanosomes (PubMed:17081065).
Target Protein Families
Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family, SLC24A subfamily
Target Synonyms
Ion transporter JSX; JSX; Na(+)/K(+)/Ca(2+)-exchange protein 5; NCKX5; NCKX5_HUMAN; Slc24a5; Sodium/potassium/calcium exchanger 5; Solute carrier family 24 (sodium/potassium/calcium exchanger),member 5; Solute carrier family 24 member 5; Solute carrier family 24,member 5
Target Background
This gene is a member of the potassium-dependent sodium/calcium exchanger family and encodes an intracellular membrane protein with 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments. Sequence variation in this gene has been associated with differences in skin pigmentation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
