-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 14-124 of human SLC25A1 (NP_005975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC25A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 14-124 of human SLC25A1 (NP_005975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08314A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A1 |
| Target Synonyms | SLC25A1; CTP; D2L2AD; SEA; SLC20A3; solute carrier family 25 member 1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 14-124 of human SLC25A1 (NP_005975.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRG | Uniprot ID | P53007 |
Uniprot Id
P53007
Target Species
Human
Target Name
SLC25A1
Target Full Name
Tricarboxylate transport protein, mitochondrial
Target Function
Citrate transporter that mediates the exchange of mitochondrial citrate for cytosolic malate. Also able to mediate the exchange of citrate for isocitrate, phosphoenolpyruvate, cis- but not trans-aconitate and to a lesser extend maleate and succinate. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway. Required for proper neuromuscular junction formation.
Target Involvement
Combined D-2- and L-2-hydroxyglutaric aciduria (D2L2AD)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Research Area
Transport
Target Synonyms
Citrate transport protein; CTP; mitochondrial; SLC20A3; Slc25a1; solute carrier family 20 (mitochondrial citrate transporter), member 3; solute carrier family 25 (mitochondrial carrier, citrate transporter), member 1; Solute carrier family 25 member 1; Tricarboxylate carrier protein; Tricarboxylate transport protein; tricarboxylate transport protein, mitochondrial; TXTP_HUMAN
Target Background
This gene encodes a member of the mitochondrial carrier subfamily of solute carrier proteins. Members of this family include nuclear-encoded transporters that translocate small metabolites across the mitochondrial membrane. This protein regulates the movement of citrate across the inner membranes of the mitochondria. Mutations in this gene have been associated with combined D-2- and L-2-hydroxyglutaric aciduria. Pseudogenes of this gene have been identified on chromosomes 7, 11, 16, and 19. Alternative splicing results in multiple transcript variants.
Notification