Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC25A16 (NP_689920.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC25A16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC25A16 (NP_689920.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04372A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A16 |
| Target Synonyms | GDA; GDC; ML7; hML7; HGT.1; D10S105E; SLC25A16 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC25A16 (NP_689920.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL | Uniprot ID | P16260 |
Uniprot Id
P16260
Target Species
Human
Target Name
SLC25A16
Target Full Name
Solute carrier family 25 member 16
Target Function
Required for the accumulation of coenzyme A in the mitochondrial matrix.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Synonyms
SLC25A16; GDA; Graves disease carrier protein; GDC; Graves disease autoantigen; Mitochondrial solute carrier protein homolog; Solute carrier family 25 member 16
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
