-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC2A9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 429-529 of human SLC2A9 (NP_064425.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC2A9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 429-529 of human SLC2A9 (NP_064425.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10192A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC2A9 |
| Target Synonyms | GLUT9; GLUTX; UAQTL2; URATv1; SLC2A9 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 429-529 of human SLC2A9 (NP_064425.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDS | Uniprot ID | Q9NRM0 |
Uniprot Id
Q9NRM0
Target Species
Human
Target Name
SLC2A9
Target Full Name
Solute carrier family 2, facilitated glucose transporter member 9
Target Function
Urate transporter, which may play a role in the urate reabsorption by proximal tubules. Does not transport glucose, fructose or galactose.
Target Involvement
Hypouricemia renal 2 (RHUC2)
Target Subcellular Location
[Isoform 1]: Basolateral cell membrane; Multi-pass membrane protein.; [Isoform 2]: Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
Target Tissue Specificity
Most strongly expressed in basolateral membranes of proximal renal tubular cells, liver and placenta. Also detected in lung, blood leukocytes, heart skeletal muscle and chondrocytes from articular cartilage. Isoform 2 is only detected in the apical membra
Target Synonyms
glucose transporter 9; Glucose transporter like protein 9; Glucose transporter type 9; GLUT 9; GLUT-9; GLUT9; GLUTX; GTR9_HUMAN; Human glucose transporter like protein 9; SLC2A9; Solute carrier family 2 (facilitated glucose transporter) member 9; Solute carrier family 2 facilitated glucose transporter member 9; Solute carrier family 2 member 9; Solute carrier family 2 member 9 protein; Solute carrier family 2, facilitated glucose transporter member 9; UAQTL2; Urate voltage driven efflux transporter 1; URATv1
Target Background
This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Notification