Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC5A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SLC5A2 (NP_003032.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SLC5A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SLC5A2 (NP_003032.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12371A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC5A2 |
| Target Synonyms | SGLT2; SLC5A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SLC5A2 (NP_003032.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS | Uniprot ID | P31639 |
Uniprot Id
P31639
Target Species
Human
Target Name
SLC5A2
Target Full Name
Sodium/glucose cotransporter 2
Target Function
Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Target Involvement
Renal glucosuria (GLYS)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Target Research Area
Signal Transduction
Target Synonyms
SLC5A2; SGLT2; Sodium/glucose cotransporter 2; Na(+/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2
Target Background
This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. Two transcript variants, one protein-coding and one not, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
