Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC6A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC6A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06922A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC6A8 |
| Target Synonyms | CRT; CT1; CRT1; CRTR; CTR5; CCDS1; CRT-1; SLC6A8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM | Uniprot ID | P48029 |
Uniprot Id
P48029
Target Species
Human
Target Name
SLC6A8
Target Full Name
Sodium- and chloride-dependent creatine transporter 1
Target Function
Required for the uptake of creatine in muscles and brain.
Target Involvement
Cerebral creatine deficiency syndrome 1 (CCDS1)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A8 subfamily
Target Tissue Specificity
Predominantly expressed in skeletal muscle and kidney. Also found in brain, heart, colon, testis and prostate.
Target Synonyms
SLC6A 8; SLC6A8; Creatine transporter 1; Creatine transporter SLC6A8; CRT; CRTR; CT 1; CT1; MGC87396; SC6A8_HUMAN; Slc6a8; Sodium and chloride-dependent creatine transporter 1; Sodium- and chloride-dependent creatine transporter 1; Solute carrier family 6 (neurotransmitter transporter, creatine), member 8.; Solute carrier family 6 member 8
Target Background
The protein encoded by this gene is a plasma membrane protein whose function is to transport creatine into and out of cells. Defects in this gene can result in X-linked creatine deficiency syndrome. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
