-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC8A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human SLC8A2 (NP_055878.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC8A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human SLC8A2 (NP_055878.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04884A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC8A2 |
| Target Synonyms | NCX2; SLC8A2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human SLC8A2 (NP_055878.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQGGEGNSTFYVDYRTEDGSAKAGSDYEYSEGT | Uniprot ID | Q9UPR5 |
Uniprot Id
Q9UPR5
Target Species
Human
Target Name
SLC8A2
Target Full Name
Sodium/calcium exchanger 2
Target Function
Mediates the electrogenic exchange of Ca(2+) against Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes. Contributes to cellular Ca(2+) homeostasis in excitable cells. Contributes to the rapid decrease of cytoplasmic Ca(2+) levels back to baseline after neuronal activation, and thereby contributes to modulate synaptic plasticity, learning and memory. Plays a role in regulating urinary Ca(2+) and Na(+) excretion.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Perikaryon. Cell projection, dendrite. Cell projection, dendritic spine.
Target Protein Families
Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family, SLC8 subfamily
Target Synonyms
SLC8A2; KIAA1087; NCX2; Sodium/calcium exchanger 2; Na(+)/Ca(2+)-exchange protein 2; Solute carrier family 8 member 2
Target Background
Predicted to enable calcium:cation antiporter activity involved in regulation of postsynaptic cytosolic calcium ion concentration and calcium:sodium antiporter activity. Predicted to be involved in several processes, including inorganic cation transmembrane transport; learning or memory; and regulation of short-term neuronal synaptic plasticity. Predicted to act upstream of or within several processes, including modulation of chemical synaptic transmission; regulation of action potential firing pattern; and response to ischemia. Part of presynapse. Biomarker of Alzheimer's disease.
Notification