-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMARCD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 454-531 of human SMARCD2 (NP_001091896.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SMARCD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 454-531 of human SMARCD2 (NP_001091896.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02169A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMARCD2 |
| Target Synonyms | SGD2; Rsc6p; BAF60B; CRACD2; PRO2451; SMARCD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 454-531 of human SMARCD2 (NP_001091896.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT | Uniprot ID | Q92925 |
Uniprot Id
Q92925
Target Species
Human
Target Name
SMARCD2
Target Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
Target Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Critical regulator of myeloid differentiation, controlling granulocytopoiesis and the expression of genes involved in neutrophil granule formation.
Target Involvement
Specific granule deficiency 2 (SGD2)
Target Subcellular Location
Nucleus.
Target Protein Families
SMARCD family
Target Tissue Specificity
Isoform 2 is expressed in the pancreas.
Target Synonyms
SMARCD2; BAF60B; PRO2451; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2; 60 kDa BRG-1/Brm-associated factor subunit B; BRG1-associated factor 60B; BAF60B
Target Background
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification