-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMURF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against SMURF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-16898A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMURF2 |
| Target Synonyms | SMURF2; E3 ubiquitin-protein ligase SMURF2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse brain, Mouse lung, Mouse testis, SH-SY5Y, U2OS | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN | Uniprot ID | Q9HAU4 |
Uniprot Id
Q9HAU4
Target Species
Human
Target Name
SMURF2
Target Full Name
E3 ubiquitin-protein ligase SMURF2
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD7 to trigger SMAD7-mediated transforming growth factor beta/TGF-beta receptor ubiquitin-dependent degradation, thereby downregulating TGF-beta signaling. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with AIMP1. Also forms a stable complex with TGF-beta receptor-mediated phosphorylated SMAD1, SMAD2 and SMAD3, and targets SMAD1 and SMAD2 for ubiquitination and proteasome-mediated degradation. SMAD2 may recruit substrates, such as SNON, for ubiquitin-dependent degradation. Negatively regulates TGFB1-induced epithelial-mesenchymal transition and myofibroblast differentiation.; (Microbial infection) In case of filoviruses Ebola/EBOV and Marburg/MARV infection, the complex formed by viral matrix protein VP40 and SMURF2 facilitates virus budding.
Target Subcellular Location
Nucleus. Cytoplasm. Cell membrane. Membrane raft. Note=Cytoplasmic in the presence of SMAD7. Colocalizes with CAV1, SMAD7 and TGF-beta receptor in membrane rafts.
Target Tissue Specificity
Widely expressed.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
E3 ubiquitin-protein ligase SMURF2; EC 6.3.2.; hSMURF2; MGC138150; Smad specific E3 ubiquitin ligase 2; SMAD specific E3 ubiquitin protein ligase 2; SMAD ubiquitination regulatory factor 2; SMAD-specific E3 ubiquitin-protein ligase 2; SMUF2_HUMAN; Smurf2; Ubiquitin protein ligase SMURF2
Target Background
Enables SMAD binding activity; identical protein binding activity; and ubiquitin-protein transferase activity. Involved in negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of trophoblast cell migration; and ubiquitin-dependent SMAD protein catabolic process. Located in nuclear speck. Part of ubiquitin ligase complex.
Notification