Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNTB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SNTB1 (NP_066301.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SNTB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SNTB1 (NP_066301.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06924A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNTB1 |
| Target Synonyms | A1B; SNT2; BSYN2; 59-DAP; DAPA1B; SNT2B1; TIP-43; SNTB1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SNTB1 (NP_066301.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVAAAAAAAGPAGAGGGRAQRSGLLEVLVRDRWHKVLVNLSEDALVLSSEEGAAAYNGIGTATNGSFCRGAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQK | Uniprot ID | Q13884 |
Uniprot Id
Q13884
Target Species
Human
Target Name
SNTB1
Target Full Name
Beta-1-syntrophin
Target Function
Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex.
Target Subcellular Location
Cell membrane, sarcolemma; Peripheral membrane protein; Cytoplasmic side. Cell junction. Cytoplasm, cytoskeleton.
Target Protein Families
Syntrophin family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
59 DAP; 59 kDa dystrophin associated protein A1 basic component 1; 59 kDa dystrophin-associated protein A1 basic component 1; A1B; Beta 1 syntrophin; Beta-1-syntrophin; BSYN2; DAPA1B; Dystrophin associated protein A1 59kDa basic component 1; FLJ22442; MGC111389; SNT2; SNT2B1; SNTB 1; Sntb1; SNTB1_HUMAN; Syntrophin 2; Syntrophin beta 1; Syntrophin beta 1 (dystrophin associated protein A1 59kDa basic component 1); Syntrophin-2; Tax interaction protein 43; TIP 43; TIP-43
Target Background
Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
