-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SOX7 (NP_113627.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOX7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SOX7 (NP_113627.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05361A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX7 |
| Target Synonyms | SOX7; SRY-box 7 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SOX7 (NP_113627.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMA | Uniprot ID | Q9BT81 |
Uniprot Id
Q9BT81
Target Species
Human
Target Name
SOX7
Target Full Name
Transcription factor SOX-7
Target Function
Binds to and activates the CDH5 promoter, hence plays a role in the transcriptional regulation of genes expressed in the hemogenic endothelium and blocks further differentiation into blood precursors. May be required for the survival of both hematopoietic and endothelial precursors during specification. Competes with GATA4 for binding and activation of the FGF3 promoter. Represses Wnt/beta-catenin-stimulated transcription, probably by targeting CTNNB1 to proteasomal degradation. Binds the DNA sequence 5'-AACAAT-3'.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Widely expressed in adult and fetal tissues. Present both in mesenchymal and epithelial cells in some adult tissues, including colon. Tends to be down-regulated in prostate adenocarcinomas and colorectal tumors due to promoter hypermethylation.
Target Synonyms
MGC10895; SOX 7; SOX 7 transcription factor; sox7; SOX7 transcription factor; SOX7_HUMAN; SRY (sex determining region Y) box 7; SRY box 7; SRY sex determining region Y box 7; Transcription factor SOX 7; Transcription factor Sox-7; Transcription factor SOX7
Target Background
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.
Notification