Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPINK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-79 of human SPINK1 (NP_003113.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against SPINK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-79 of human SPINK1 (NP_003113.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of HeLa cells using SPINK1 antibody. Blue: DAPI for nuclear staining.
| Cat.No | ADA-06183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPINK1 |
| Target Synonyms | TCP; PCTT; PSTI; TATI; Spink3; SPINK1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-79 of human SPINK1 (NP_003113.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC | Uniprot ID | P00995 |
Uniprot Id
P00995
Target Species
Human
Target Name
SPINK1
Target Full Name
Serine protease inhibitor Kazal-type 1
Target Function
Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.
Target Involvement
Pancreatitis, hereditary (PCTT); Tropical calcific pancreatitis (TCP)
Target Subcellular Location
Secreted.
Target Research Area
Cell Biology
Target Synonyms
ISK1_HUMAN; Pancreatic secretory trypsin inhibitor; Pancreatic serine protease inhibitor Kazal; PCTT; PSTI; Serine protease inhibitor Kazal type 1; Serine protease inhibitor Kazal-type 1; Spink 3; SPINK1; Spink3; TaTI; TCP; Tumor associated trypsin inhibitor; Tumor-associated trypsin inhibitor
Target Background
The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
