-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRA1 (NP_001030312.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SRA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRA1 (NP_001030312.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06686A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRA1 |
| Target Synonyms | SRA; SRAP; STRAA1; pp7684; SRA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRA1 (NP_001030312.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP | Uniprot ID | Q9HD15 |
Uniprot Id
Q9HD15
Target Species
Human
Target Name
SRA1
Target Full Name
Steroid receptor RNA activator 1
Target Function
Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
SRA1 family
Target Tissue Specificity
Highly expressed in liver and skeletal muscle and to a lesser extent in brain. Also expressed in both normal and tumorigenic breast epithelial cell lines. Significantly up-regulated in human tumors of the breast, ovary, and uterus.
Target Synonyms
MGC87674; PP7684; SR A1; SRA; SRA1; SRA1_HUMAN; SRAP; Steroid receptor coactivator; Steroid receptor RNA activator 1 (complexes with NCOA1); Steroid receptor RNA activator 1; Steroid receptor RNA activator protein; STRAA1
Target Background
Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA.
Notification