-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 321-420 of human SRF (NP_003122.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 321-420 of human SRF (NP_003122.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09288A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRF |
| Target Synonyms | MCM1; SRF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, A-431 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 321-420 of human SRF (NP_003122.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT | Uniprot ID | P11831 |
Uniprot Id
P11831
Target Species
Human
Target Name
SRF
Target Full Name
Serum response factor
Target Function
SRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS). Together with MRTFA transcription coactivator, controls expression of genes regulating the cytoskeleton during development, morphogenesis and cell migration. The SRF-MRTFA complex activity responds to Rho GTPase-induced changes in cellular globular actin (G-actin) concentration, thereby coupling cytoskeletal gene expression to cytoskeletal dynamics. Required for cardiac differentiation and maturation.
Target Subcellular Location
Nucleus.
Target Research Area
Cardiovascular
Target Synonyms
c fos serum response element binding factor; c fos serum response element binding transcription factor; ELK3; ERP; MCM 1; MCM1; OTTHUMP00000039820; SAP2; Serum response factor; SRF; SRF serum response factor c fos serum response element binding transcription factor; SRF_HUMAN
Target Background
This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene.
Notification