Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRP19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human SRP19 (NP_003126.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SRP19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human SRP19 (NP_003126.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02860A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRP19 |
| Target Synonyms | SRP19 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human SRP19 (NP_003126.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK | Uniprot ID | P09132 |
Uniprot Id
P09132
Target Species
Human
Target Name
SRP19
Target Full Name
Signal recognition particle 19 kDa protein
Target Function
Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
Target Subcellular Location
Cytoplasm.
Target Protein Families
SRP19 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Signal recognition particle 19 kDa protein; signal recognition particle 19kDa; SRP19; SRP19_HUMAN
Target Background
Enables 7S RNA binding activity. Contributes to ribosome binding activity. Predicted to be involved in SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition. Located in nucleolus. Part of signal recognition particle, endoplasmic reticulum targeting.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
