Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRP72 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-544 of human SRP72 (NP_008878.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SRP72 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-544 of human SRP72 (NP_008878.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01715A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRP72 |
| Target Synonyms | BMFF; BMFS1; HEL103; SRP72 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 440-544 of human SRP72 (NP_008878.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKDIHTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSAGATYIRKKGGKVTGDSQPK | Uniprot ID | O76094 |
Uniprot Id
O76094
Target Species
Human
Target Name
SRP72
Target Full Name
Signal recognition particle subunit SRP72
Target Function
Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Binds the 7S RNA only in presence of SRP68. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
Target Involvement
Bone marrow failure syndrome 1 (BMFS1)
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum.
Target Protein Families
SRP72 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
BMFF; BMFS1; Epididymis luminal protein 103; HEL103; Signal recognition particle 72 kDa protein; Signal recognition particle 72kDa; Signal recognition particle subunit SRP72; SRP72; SRP72_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
