-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRSF6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF6 (NP_006266.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SRSF6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF6 (NP_006266.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10826A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRSF6 |
| Target Synonyms | B52; SFRS6; SRP55; HEL-S-91; SRSF6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, HT-29, K-562, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF6 (NP_006266.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRD | Uniprot ID | Q13247 |
Uniprot Id
Q13247
Target Species
Human
Target Name
SRSF6
Target Full Name
Serine/arginine-rich splicing factor 6
Target Function
Plays a role in constitutive splicing and modulates the selection of alternative splice sites. Plays a role in the alternative splicing of MAPT/Tau exon 10. Binds to alternative exons of TNC pre-mRNA and promotes the expression of alternatively spliced TNC. Plays a role in wound healing and in the regulation of keratinocyte differentiation and proliferation via its role in alternative splicing.
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Protein Families
Splicing factor SR family
Target Synonyms
arginine/serine-rich 6; B52; Epididymis secretory protein Li 91; fc17h09; HEL S 91; MGC128807 ; MGC5045; Pre mRNA splicing factor SRP55; Pre-mRNA-splicing factor SRP55; Serine/arginine-rich splicing factor 6; SFRS6; Splicing factor; Splicing factor arginine/serine rich 55 kDa; Splicing factor arginine/serine rich 6; SR splicing factor 6; SRP55; SRSF6; SRSF6_HUMAN; wu:faa54g02; wu:fc17h09; zgc:103497
Target Background
The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Alternative splicing results in multiple transcript variants. In addition, two pseudogenes, one on chromosome 17 and the other on the X chromosome, have been found for this gene.
Notification