-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ST3GAL4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 234-333 of human ST3GAL4(NP_001241686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ST3GAL4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 234-333 of human ST3GAL4(NP_001241686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08428A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ST3GAL4 |
| Target Synonyms | ST3GAL4; CGS23; NANTA3; SAT3; SIAT4; SIAT4C; ST-4; ST3GalA.2; ST3GalIV; STZ; gal-NAc6S; ST3 beta-galactoside alpha-2; 3-sialyltransferase 4 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 234-333 of human ST3GAL4(NP_001241686.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF | Uniprot ID | Q11206 |
Uniprot Id
Q11206
Target Species
Human
Target Name
ST3GAL4
Target Full Name
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
Target Function
A beta-galactoside alpha2-3 sialyltransferase involved in terminal sialylation of glycoproteins and glycolipids. Catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc- and Galbeta-(1->4)-GlcNAc-terminated glycoconjugates through an alpha2-3 linkage. Plays a major role in hemostasis. Responsible for sialylation of plasma VWF/von Willebrand factor, preventing its recognition by asialoglycoprotein receptors (ASGPR) and subsequent clearance. Regulates ASGPR-mediated clearance of platelets. Participates in the biosynthesis of the sialyl Lewis X epitopes, both on O- and N-glycans, which are recognized by SELE/E-selectin, SELP/P-selectin and SELL/L-selectin. Essential for selectin-mediated rolling and adhesion of leukocytes during extravasation. Contributes to adhesion and transendothelial migration of neutrophils likely through terminal sialylation of CXCR2. In glycosphingolipid biosynthesis, sialylates GM1 and GA1 gangliosides to form GD1a and GM1b, respectively. Metabolizes brain c-series ganglioside GT1c forming GQ1c. Synthesizes ganglioside LM1 (IV3Neu5Ac-nLc4Cer), a major structural component of peripheral nerve myelin.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
Target Protein Families
Glycosyltransferase 29 family
Target Tissue Specificity
Highly expressed in adult placenta, heart and kidney.
Target Synonyms
ST3GAL4; CGS23; NANTA3; SIAT4C; STZ; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Alpha 2,3-ST 4; Beta-galactoside alpha-2,3-sialyltransferase 4; EC 2.4.99.2; EC 2.4.99.4; Alpha 2,3-sialyltransferase IV; Gal-NAc6S; Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; SAT-3; ST-4; ST3Gal IV; ST3GalIV; ST3GalA.2; STZ; Sialyltransferase 4C; SIAT4-C
Target Background
This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification