-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ST3GAL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-200 of human ST3GAL5 (NP_003887.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ST3GAL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-200 of human ST3GAL5 (NP_003887.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01860A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ST3GAL5 |
| Target Synonyms | SATI; SIAT9; SPDRS; ST3GalV; SIATGM3S; ST3Gal V; ST3GAL5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, Mouse brain, SH-SY5Y, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-200 of human ST3GAL5 (NP_003887.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS | Uniprot ID | Q9UNP4 |
Uniprot Id
Q9UNP4
Target Species
Human
Target Name
ST3GAL5
Target Full Name
Lactosylceramide alpha-2,3-sialyltransferase
Target Function
Transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose (Gal) of glycosphingolipids forming gangliosides (important molecules involved in the regulation of multiple cellular processes, including cell proliferation and differentiation, apoptosis, embryogenesis, development, and oncogenesis). Mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1), although less preferentially than beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer (LacCer).
Target Involvement
Salt and pepper developmental regression syndrome (SPDRS)
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 29 family
Target Tissue Specificity
Ubiquitous. High expression in brain, skeletal muscle, placenta, and testis. mRNA widely distributed in human brain, but slightly elevated expression was observed in the cerebral cortex, temporal lobe, and putamen.
Target Synonyms
3-sialyltransferase; CMP-NeuAc:lactosylceramide alpha-2; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; EC 2.4.99.9; Ganglioside GM3 synthase; Lactosylceramide alpha-2,3-sialyltransferase; Sialyltransferase 9; SIAT9; SIAT9_HUMAN; SIATGM3S; ST3 beta-galactoside alpha-2,3-sialyltransferase 5; ST3GAL; ST3Gal V; ST3GAL5; ST3GalV
Target Background
Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene.
Notification