Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAMBPL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human STAMBPL1 (NP_065850.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STAMBPL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human STAMBPL1 (NP_065850.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10039A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAMBPL1 |
| Target Synonyms | AMSH-FP; AMSH-LP; ALMalpha; bA399O19.2; STAMBPL1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human STAMBPL1 (NP_065850.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALT | Uniprot ID | Q96FJ0 |
Uniprot Id
Q96FJ0
Target Species
Human
Target Name
STAMBPL1
Target Full Name
AMSH-like protease
Target Function
Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.
Target Protein Families
Peptidase M67C family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
ALMalpha; AMSH FP; AMSH LP; AMSH-like protease; AMSH-LP; AMSHFP; AMSHLP; Associated molecule with the SH3 domain of STAM (AMSH) like protein; FLJ31524; OTTHUMP00000020055; STALP_HUMAN; STAM binding protein like 1; STAM-binding protein-like 1; STAMBPL1
Target Background
Predicted to enable Lys63-specific deubiquitinase activity and thiol-dependent deubiquitinase. Predicted to be involved in protein K63-linked deubiquitination. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
