Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STARD3NL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 185-234 of human STARD3NL (NP_114405.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against STARD3NL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 185-234 of human STARD3NL (NP_114405.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00181A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STARD3NL |
| Target Synonyms | MENTHO; STARD3NL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, MCF7, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 185-234 of human STARD3NL (NP_114405.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL | Uniprot ID | O95772 |
Uniprot Id
O95772
Target Species
Human
Target Name
STARD3NL
Target Full Name
STARD3 N-terminal-like protein
Target Function
Tethering protein that creates contact site between the endoplasmic reticulum and late endosomes: localizes to late endosome membranes and contacts the endoplasmic reticulum via interaction with VAPA and VAPB.
Target Subcellular Location
Late endosome membrane; Multi-pass membrane protein.
Target Protein Families
STARD3 family
Target Synonyms
STARD3NL; MENTHO; UNQ855/PRO1864; STARD3 N-terminal-like protein; MLN64 N-terminal domain homolog
Target Background
This gene encodes a late-endosomal protein that contains a conserved MENTAL (MLN64 N-terminal) domain. The encoded protein binds cholesterol molecules and may play a role in endosomal cholesterol transport through interactions with metastatic lymph node protein 64 (MLN64).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
