-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAT5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-787 of human STAT5B (P51692) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against STAT5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-787 of human STAT5B (P51692) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-17237A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAT5B |
| Target Synonyms | STAT5; GHISID2; 5B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, K-562, Mouse thymus | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-787 of human STAT5B (P51692). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS | Uniprot ID | P51692 |
Uniprot Id
P51692
Target Species
Human
Target Name
STAT5B
Target Full Name
Signal transducer and activator of transcription 5B
Target Function
Carries out a dual signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription. Positively regulates hematopoietic/erythroid differentiation.
Target Involvement
Growth hormone insensitivity with immunodeficiency (GHII)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Transcription factor STAT family
Target Synonyms
Signal transducer and activator of transcription 5B; STA5B_HUMAN; STAT5; Stat5b; Transcription factor STAT5B
Target Background
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.
Notification