-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STIM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 530-685 of human STIM1 (NP_003147.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against STIM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 530-685 of human STIM1 (NP_003147.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-12314A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STIM1 |
| Target Synonyms | GOK; TAM; TAM1; IMD10; STRMK; D11S4896E; STIM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, K-562, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 530-685 of human STIM1 (NP_003147.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK | Uniprot ID | Q13586 |
Uniprot Id
Q13586
Target Species
Human
Target Name
STIM1
Target Full Name
Stromal interaction molecule 1
Target Function
Plays a role in mediating store-operated Ca(2+) entry (SOCE), a Ca(2+) influx following depletion of intracellular Ca(2+) stores. Acts as Ca(2+) sensor in the endoplasmic reticulum via its EF-hand domain. Upon Ca(2+) depletion, translocates from the endoplasmic reticulum to the plasma membrane where it activates the Ca(2+) release-activated Ca(2+) (CRAC) channel subunit ORAI1. Involved in enamel formation. Activated following interaction with STIMATE, leading to promote STIM1 conformational switch.
Target Involvement
Immunodeficiency 10 (IMD10); Myopathy, tubular aggregate, 1 (TAM1); Stormorken syndrome (STRMK)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Cytoplasm, cytoskeleton. Sarcoplasmic reticulum.
Target Tissue Specificity
Ubiquitously expressed in various human primary cells and tumor cell lines.
Target Synonyms
D11S4896E; GOK; OTTHUMP00000164512; OTTHUMP00000229140; OTTHUMP00000230742; SIM; STIM 1; STIM1; Stim1 stromal interaction molecule 1; STIM1_HUMAN; STIM1L; Stromal interaction molecule 1
Target Background
This gene encodes a type 1 transmembrane protein that mediates Ca2+ influx after depletion of intracellular Ca2+ stores by gating of store-operated Ca2+ influx channels (SOCs). It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region, as well as early hematopoiesis, by mediating attachment to stromal cells. Mutations in this gene are associated with fatal classic Kaposi sarcoma, immunodeficiency due to defects in store-operated calcium entry (SOCE) in fibroblasts, ectodermal dysplasia and tubular aggregate myopathy. This gene is oriented in a head-to-tail configuration with the ribonucleotide reductase 1 gene (RRM1), with the 3' end of this gene situated 1.6 kb from the 5' end of the RRM1 gene. Alternative splicing of this gene results in multiple transcript variants.
Notification