Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STK35 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-380 of human STK35 (NP_543026.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STK35 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-380 of human STK35 (NP_543026.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07125A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STK35 |
| Target Synonyms | CLIK1; STK35L1; STK35 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-380 of human STK35 (NP_543026.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPEGGGGSARPRYSLLAEIGRGSYGVVYEAVAGRSGARVAVKKIRCDAPENVELALAEFWALTSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWFVMEFCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAFLHKNHIVHRDLKPDNILITERSGTPILKVA | Uniprot ID | Q8TDR2 |
Uniprot Id
Q8TDR2
Target Species
Human
Target Name
STK35
Target Full Name
Serine/threonine-protein kinase 35
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Cytoplasm.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Target Tissue Specificity
Expressed in testis.
Target Synonyms
CLIK-1; Clik1; CLP 36 interacting kinase; CLP-36-interacting kinase 1; EC 2.7.1.37; PDLIM1 interacting kinase; PDLIM1-interacting kinase 1; Serine threonine kinase 35 long form; Serine/threonine kinase 35; Serine/threonine protein kinase 35; Serine/threonine-protein kinase 35; Serine/threonine-protein kinase 35 L1; STK35; STK35_HUMAN; STK35L1
Target Background
The protein encoded by this gene is a kinase that is predominantly found in the nucleus. However, it can interact with PDLIM1/CLP-36 in the cytoplasm and localize to actin stress fibers. The encoded protein may be a regulator of actin stress fibers in nonmuscle cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
