-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STMN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STMN2 (NP_008960.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STMN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STMN2 (NP_008960.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00495A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STMN2 |
| Target Synonyms | SCG10; SCGN10; STMN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STMN2 (NP_008960.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLS | Uniprot ID | Q93045 |
Uniprot Id
Q93045
Target Species
Human
Target Name
STMN2
Target Full Name
Stathmin-2
Target Function
Regulator of microtubule stability. When phosphorylated by MAPK8, stabilizes microtubules and consequently controls neurite length in cortical neurons. In the developing brain, negatively regulates the rate of exit from multipolar stage and retards radial migration from the ventricular zone.
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Cell projection, growth cone. Membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, axon. Golgi apparatus. Endosome. Cell projection, lamellipodium.
Target Protein Families
Stathmin family
Target Tissue Specificity
Neuron specific.
Target Research Area
Neuroscience
Target Synonyms
Neuron specific growth associated protein; Neuronal growth associated protein; Neuronal growth associated protein (silencer element); Protein SCG10; SCG 10; SCG10; SCG10 protein; SCGN 10; SCGN10; SGC 10; SGC10; Stathmin 2; Stathmin like 2; Stathmin-2; STMN 2; STMN2; STMN2_HUMAN; Superior cervical ganglia neural specific 10; Superior cervical ganglion 10 protein; Superior cervical ganglion-10 protein; Superiorcervical ganglia neural specific 10
Target Background
This gene encodes a member of the stathmin family of phosphoproteins. Stathmin proteins function in microtubule dynamics and signal transduction. The encoded protein plays a regulatory role in neuronal growth and is also thought to be involved in osteogenesis. Reductions in the expression of this gene have been associated with Down's syndrome and Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 6.
Notification