Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STX7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human STX7 (NP_003560.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against STX7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human STX7 (NP_003560.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01805A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STX7 |
| Target Synonyms | STX7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human STX7 (NP_003560.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHE | Uniprot ID | O15400 |
Uniprot Id
O15400
Target Species
Human
Target Name
STX7
Target Full Name
Syntaxin-7
Target Function
May be involved in protein trafficking from the plasma membrane to the early endosome (EE) as well as in homotypic fusion of endocytic organelles. Mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes.
Target Subcellular Location
Early endosome membrane; Single-pass type IV membrane protein.
Target Protein Families
Syntaxin family
Target Tissue Specificity
Highest expression is found in placenta followed by heart, skeletal muscle, kidney and brain. Low expression is found in pancreas, lung and liver.
Target Synonyms
STX7; Syntaxin-7
Target Background
The protein encoded by this gene is a syntaxin family membrane receptor involved in vesicle transport. The encoded protein binds alpha-SNAP, an important regulator of transport vesicle fusion. Along with syntaxin 13, this protein plays a role in the ordered fusion of endosomes and lysosomes with the phagosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
