Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 159-333 of human SUGT1 (NP_006695.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SUGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 159-333 of human SUGT1 (NP_006695.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05949A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUGT1 |
| Target Synonyms | SGT1; SUGT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-431, Jurkat, Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 159-333 of human SUGT1 (NP_006695.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY | Uniprot ID | Q9Y2Z0 |
Uniprot Id
Q9Y2Z0
Target Species
Human
Target Name
SUGT1
Target Full Name
Protein SGT1 homolog
Target Function
May play a role in ubiquitination and subsequent proteasomal degradation of target proteins.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Translocates to the nucleus upon heat shock, requiring S100A6.
Target Protein Families
SGT1 family
Target Synonyms
Protein 40 6 3; Protein 40-6-3; Protein SGT1 homolog; Putative 40 6 3 protein; Sgt1; SGT1 suppressor of G2 allele of SKP1; SGT1_HUMAN; SGT1B protein; sugt1; Suppressor of G2 allele of SKP1 homolog; Suppressor of G2 allele of SKP1 S. cerevisiae homolog of
Target Background
This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
