-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SULF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-610 of human SULF1 (NP_001121676.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SULF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-610 of human SULF1 (NP_001121676.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10272A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SULF1 |
| Target Synonyms | SULF-1; SULF1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, PC-3, Rat testis, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 480-610 of human SULF1 (NP_001121676.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDLLTVRQSTRNLYARGFHDKDKECSCRESGYRASRSQRKSQRQFLRNQGTPKYKPRFVHTRQTRSLSVEFEGEIYDINLEEEEELQVLQPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPT | Uniprot ID | Q8IWU6 |
Uniprot Id
Q8IWU6
Target Species
Human
Target Name
SULF1
Target Full Name
Extracellular sulfatase Sulf-1
Target Function
Exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. It can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin. Diminishes HSPG (heparan sulfate proteoglycans) sulfation, inhibits signaling by heparin-dependent growth factors, diminishes proliferation, and facilitates apoptosis in response to exogenous stimulation.
Target Subcellular Location
Endoplasmic reticulum. Golgi apparatus, Golgi stack. Cell surface.
Target Protein Families
Sulfatase family
Target Tissue Specificity
Expressed at highest levels in testis, stomach, skeletal muscle, lung, kidney, pancreas, small intestine and colon. It is also detected in normal ovarian surface epithelial cells. Down-regulation seen in ovarian carcinoma cell lines, ovarian cancers, brea
Target Synonyms
DSulf; Extracellular sulfatase Sulf 1; Extracellular sulfatase Sulf-1; Extracellular sulfatase Sulf1 ; HSULF 1; HSulf-1; Neu5; Sulf1; SULF1_HUMAN; Sulfatase FP; Sulfated
Target Background
This gene encodes an extracellular heparan sulfate endosulfatase. The encoded enzyme selectively removes 6-O-sulfate groups from heparan sulfate chains of heparan sulfate proteoglycans (HSPGs). The enzyme is secreted through the Golgi and is subsequently localized to the cell surface. The expression of this gene may be down-regulated in several types of cancer, including hepatocellular (HCC), ovarian and breast cancers. Alternative splicing results in multiple transcript variants.
Notification