Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Syntaxin 16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Syntaxin 16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of various lysates, using Syntaxin 16 Rabbit mAb at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
| Cat.No | ADA-13203A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Syntaxin 16 |
| Target Synonyms | SYN16; SYN-16; Syntaxin 16 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, Mouse lung, Mouse thymus, Rat pancreas, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELA | Uniprot ID | O14662 |
Uniprot Id
O14662
Target Species
Human
Target Name
STX16
Target Full Name
Syntaxin-16
Target Function
SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
Target Involvement
Pseudohypoparathyroidism 1B (PHP1B)
Target Subcellular Location
Golgi apparatus membrane; Single-pass type IV membrane protein.; [Isoform C]: Cytoplasm.
Target Protein Families
Syntaxin family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
STX16; Syntaxin-16; Syn16
Target Background
This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
