-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tafazzin / TAZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Tafazzin / TAZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09540A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Tafazzin / TAZ |
| Target Synonyms | EFE; TAZ; BTHS; EFE2; G4.5; Taz1; CMD3A; LVNCX; Tafazzin / TAZ | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR | Uniprot ID | Q16635 |
Uniprot Id
Q16635
Target Species
Human
Target Name
TAZ
Target Full Name
Tafazzin
Target Function
Acyltransferase required to remodel newly synthesized phospholipid cardiolipin (1',3'-bis-Catalytically inactive.; Catalytically inactive.
Target Involvement
Barth syndrome (BTHS)
Target Subcellular Location
Mitochondrion outer membrane; Peripheral membrane protein; Intermembrane side. Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.; [Isoform 1]: Mitochondrion membrane.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Mitochondrion membrane.; [Isoform 5]: Mitochondrion membrane.; [Isoform 6]: Cytoplasm.; [Isoform 7]: Mitochondrion membrane.; [Isoform 8]: Cytoplasm.; [Isoform 9]: Cytoplasm.
Target Protein Families
Taffazin family
Target Tissue Specificity
High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal
Target Synonyms
Barth syndrome; BTHS; Cardiomyopathy dilated 3A (X linked); CMD3A; EFE; EFE2; Endocardial fibroelastosis 2; G4.5; LVNCX; Protein G4.5; Tafazzin; TAZ; TAZ protein; TAZ_HUMAN; Taz1
Target Background
This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Notification