-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBL1XR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-170 of human TBL1XR1 (NP_078941.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TBL1XR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-170 of human TBL1XR1 (NP_078941.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06245A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBL1XR1 |
| Target Synonyms | C21; DC42; IRA1; MRD41; TBLR1; TBL1XR1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-170 of human TBL1XR1 (NP_078941.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHES | Uniprot ID | Q9BZK7 |
Uniprot Id
Q9BZK7
Target Species
Human
Target Name
TBL1XR1
Target Full Name
F-box-like/WD repeat-containing protein TBL1XR1
Target Function
F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of the N-Cor corepressor complex that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of N-Cor complex, thereby allowing cofactor exchange, and transcription activation.
Target Involvement
Pierpont syndrome (PRPTS); Mental retardation, autosomal dominant 41 (MRD41)
Target Subcellular Location
Nucleus.
Target Protein Families
WD repeat EBI family
Target Tissue Specificity
Widely expressed including the pituitary, hypothalamus, white and brown adipose tissue, muscle and liver.
Target Synonyms
C21; DC42; F box like/WD repeat containing protein TBL1XR1; F-box-like/WD repeat-containing protein TBL1XR1; FLJ12894; IRA1; Nuclear receptor corepressor/HDAC3 complex subunit; Nuclear receptor corepressor/HDAC3 complex subunit TBLR1; TBL1 related protein 1; TBL1-related protein 1; TBL1R_HUMAN; TBL1XR1; TBLR1; Transducin (beta) like 1 X linked receptor 1; Transducin beta like 1X related protein 1; Transducin beta-like 1X-related protein 1
Target Background
This gene is a member of the WD40 repeat-containing gene family and shares sequence similarity with transducin (beta)-like 1X-linked (TBL1X). The protein encoded by this gene is thought to be a component of both nuclear receptor corepressor (N-CoR) and histone deacetylase 3 (HDAC 3) complexes, and is required for transcriptional activation by a variety of transcription factors. Mutations in these gene have been associated with some autism spectrum disorders, and one finding suggests that haploinsufficiency of this gene may be a cause of intellectual disability with dysmorphism. Mutations in this gene as well as recurrent translocations involving this gene have also been observed in some tumors.
Notification