Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCEAL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TCEAL2 (NP_525129.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TCEAL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TCEAL2 (NP_525129.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03494A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCEAL2 |
| Target Synonyms | WEX1; my048; MY0876G05; TCEAL2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TCEAL2 (NP_525129.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKAKGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSER | Uniprot ID | Q9H3H9 |
Uniprot Id
Q9H3H9
Target Species
Human
Target Name
TCEAL2
Target Full Name
Transcription elongation factor A protein-like 2
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Protein Families
TFS-II family, TFA subfamily
Target Synonyms
TCEAL2; My048; MY0876G0; Transcription elongation factor A protein-like 2; TCEA-like protein 2; Transcription elongation factor S-II protein-like 2
Target Background
This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
