-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TDRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human TDRD1 (NP_942090.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TDRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human TDRD1 (NP_942090.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03309A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TDRD1 |
| Target Synonyms | CT41.1; TDRD1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human TDRD1 (NP_942090.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFNFEKNENKLPPHESLRSPGTLPNHPNFRLKSSENGNKKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVGSKGDRKKLPAGNSVSPPSAESNSPPKE | Uniprot ID | Q9BXT4 |
Uniprot Id
Q9BXT4
Target Species
Human
Target Name
TDRD1
Target Full Name
Tudor domain-containing protein 1
Target Function
Plays a central role during spermatogenesis by participating in the repression transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Required for the localization of Piwi proteins to the meiotic nuage. Involved in the piRNA metabolic process by ensuring the entry of correct transcripts into the normal piRNA pool and limiting the entry of cellular transcripts into the piRNA pathway. May act by allowing the recruitment of piRNA biogenesis or loading factors that ensure the correct entry of transcripts and piRNAs into Piwi proteins.
Target Subcellular Location
Cytoplasm.
Target Protein Families
TDRD1 family
Target Tissue Specificity
Testis and ovary specific. Also expressed in several cancers.
Target Synonyms
Cancer/testis antigen 41.1; CT41.1; FLJ21082; MTR 1; TDRD 1; tdrd1; TDRD1_HUMAN; Tudor domain containing 1; Tudor domain containing protein 1; Tudor domain-containing protein 1
Target Background
This gene encodes a protein containing a tudor domain that is thought to function in the suppression of transposable elements during spermatogenesis. The related protein in mouse forms a complex with piRNAs and Piwi proteins to promote methylation and silencing of target sequences. This gene was observed to be upregulated by ETS transcription factor ERG in prostate tumors.
Notification