-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TEAD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TEAD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12135A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TEAD4 |
| Target Synonyms | TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; TCF13L1; hRTEF-1B; TEAD4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, K-562, Mouse liver, Mouse lung, Mouse skeletal muscle, Rat liver, Rat lung, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI | Uniprot ID | Q15561 |
Uniprot Id
Q15561
Target Species
Human
Target Name
TEAD4
Target Full Name
Transcriptional enhancer factor TEF-3
Target Function
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.
Target Research Area
Transcription, Cardiovascular
Target Synonyms
EFTR 2; EFTR2; hRTEF 1B; hRTEF1B; MGC9014; OTTHUMP00000238119; OTTHUMP00000238122; OTTHUMP00000238124; Related to TEF 1; Related to TEF1; Related transcription enhancer factor 1B; RTEF1; TCF13L1; TEA domain family member 4; TEAD 4; TEAD-4; TEAD4; TEAD4_HUMAN; TEF 3; TEF3; TEFR 1; TEFR1; Transcription factor 13 (SV40 transcriptional enhancer factor) like 1; Transcription factor 13 like 1; Transcription factor 13-like 1; Transcription factor RTEF 1; Transcription factor RTEF-1; Transcription factor RTEF1; Transcriptional enhancer factor 1 related; Transcriptional enhancer factor 3; Transcriptional enhancer factor TEF 3; Transcriptional enhancer factor TEF-3; Transcriptional enhancer factor TEF3
Target Background
This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.
Notification