Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGN46/TGOLN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 323-423 of human TGN46/TGN46/TGOLN2 (NP_006455.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TGN46/TGOLN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 323-423 of human TGN46/TGN46/TGOLN2 (NP_006455.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01572A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGN46/TGOLN2 |
| Target Synonyms | TGN38; TGN46; TGN48; TGN51; TTGN2; hTGN46; hTGN48; hTGN51; TGN46/TGOLN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 323-423 of human TGN46/TGN46/TGOLN2 (NP_006455.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSKVTR | Uniprot ID | O43493 |
Uniprot Id
O43493
Target Species
Human
Target Name
TGOLN2
Target Full Name
Trans-Golgi network integral membrane protein 2
Target Function
May be involved in regulating membrane traffic to and from trans-Golgi network.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Note=Primarily in trans-Golgi network. Cycles between the trans-Golgi network and the cell surface returning via endosomes.
Target Tissue Specificity
Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.
Target Synonyms
TGOLN2; TGN46; TGN51; Trans-Golgi network integral membrane protein 2; Trans-Golgi network glycoprotein 46; TGN38 homolog; hTGN46; Trans-Golgi network glycoprotein 48; hTGN48; Trans-Golgi network glycoprotein 51; hTGN51; Trans-Golgi network protein 2
Target Background
This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a role in exocytic vesicle formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
