-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1(NP_071505.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TIA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1(NP_071505.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08539A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIA1 |
| Target Synonyms | WDM; ALS26; TIA-1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1(NP_071505.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ | Uniprot ID | P31483 |
Uniprot Id
P31483
Target Species
Human
Target Name
TIA1
Target Full Name
Cytotoxic granule associated RNA binding protein TIA1
Target Function
Involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis.
Target Involvement
Welander distal myopathy (WDM)
Target Subcellular Location
Cytoplasm, Stress granule. Nucleus.
Target Synonyms
Cytotoxic granule associated RNA binding protein 1; Cytotoxic granule associated RNA binding protein; mTIA-1; Nucleolysin TIA 1 isoform p40 ; Nucleolysin TIA-1 isoform p40; Nucleolysin TIA1 isoform p40; p40 TIA 1; p40-TIA-1 (containing p15-TIA-1); p40-TIA-1; RNA binding protein TIA 1; RNA binding protein TIA1; RNA-binding protein TIA-1; T-cell-restricted intracellular antigen-1; TIA 1; TIA 1 cytotoxic granule associated RNA binding protein ; Tia; TIA-1; TIA1; TIA1 cytotoxic granule associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein like 1; TIA1 protein; TIA1_HUMAN; TIAL1; TIAR; WDM
Target Background
The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene.
Notification