Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM165 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM165 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02299A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM165 |
| Target Synonyms | FT27; GDT1; CDG2K; TPARL; TMPT27; SLC64A1; TMEM165 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWL | Uniprot ID | Q9HC07 |
Uniprot Id
Q9HC07
Target Species
Human
Target Name
TMEM165
Target Full Name
Putative divalent cation/proton antiporter TMEM165
Target Function
May function as a calcium/proton transporter involved in calcium and in lysosomal pH homeostasis. Therefore, it may play an indirect role in protein glycosylation.
Target Involvement
Congenital disorder of glycosylation 2K (CDG2K)
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane. Lysosome membrane. Early endosome membrane. Late endosome membrane.
Target Protein Families
GDT1 family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
TMEM165; TPARL; Transmembrane protein 165; Transmembrane protein PT27; Transmembrane protein TPARL
Target Background
This gene encodes a predicted transmembrane protein with a perinuclear Golgi-like distribution in fibroblasts. Mutations in this gene are associated with the autosomal recessive disorder congenital disorder of glycosylation, type IIk. Knockdown of this gene's expression causes decreased sialylation in HEK cells and suggests this gene plays a role in terminal Golgi glycosylation. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
