-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human TMEM2 (NP_037522.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human TMEM2 (NP_037522.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07296A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM2 |
| Target Synonyms | TMEM2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human TMEM2 (NP_037522.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERVKIQAATDSKDISNCMAKAYPQYYRKPSVVKRMPAMLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRGDPSVISVNGTDFTFRSAGVLLLVV | Uniprot ID | Q9UHN6 |
Uniprot Id
Q9UHN6
Target Species
Human
Target Name
CEMIP2
Target Full Name
Cell surface hyaluronidase CEMIP2
Target Function
Unlike its mouse ortholog has no catalytic hyaluronic acid-degrading activity, but acts as a regulator of hyaluronan (HA) metabolism through regulation of expression of CEMIP and HAS2, two enzymes involved in HA depolymerization and HA synthesis, respectively.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Protein Families
TMEM2 family
Target Tissue Specificity
Widely expressed.
Target Research Area
Cell Biology
Target Synonyms
KIAA1412; TMEM 2; tmem2; TMEM2_HUMAN; Transmembrane protein 2
Target Background
This gene encodes a type II transmembrane protein that belongs to the interferon-induced transmembrane (IFITM) protein superfamily. The encoded protein functions as a cell surface hyaluronidase that cleaves extracellular high molecular weight hyaluronan into intermediate size fragments before internalization and degradation in the lysosome. It also has an interferon-mediated antiviral function in humans through activation of the JAK STAT signaling pathway. The activation of this gene by transcription factor SOX4 in breast cancer cells has been shown to mediate the pathological effects of SOX4 on cancer progression. Naturally occurring mutations in this gene are associated with autosomal recessive non-syndromic hearing loss.
Notification