Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human TMOD2 (NP_055363.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human TMOD2 (NP_055363.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05399A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMOD2 |
| Target Synonyms | NTMOD; N-TMOD; TMOD2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human TMOD2 (NP_055363.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQ | Uniprot ID | Q9NZR1 |
Uniprot Id
Q9NZR1
Target Species
Human
Target Name
TMOD2
Target Full Name
Tropomodulin-2
Target Function
Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Tropomodulin family
Target Tissue Specificity
Neuronal-tissue specific.
Target Synonyms
TMOD2; NTMOD; Tropomodulin-2; Neuronal tropomodulin; N-Tmod
Target Background
This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
