Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFAIP8L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against TNFAIP8L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-10283A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFAIP8L2 |
| Target Synonyms | TIPE2; TNFAIP8L2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse thymus, Rat spleen, THP-1 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL | Uniprot ID | Q6P589 |
Uniprot Id
Q6P589
Target Species
Human
Target Name
TNFAIP8L2
Target Full Name
Tumor necrosis factor alpha-induced protein 8-like protein 2
Target Function
Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis.
Target Protein Families
TNFAIP8 family, TNFAIP8L2 subfamily
Target Synonyms
AW610835; FLJ23467; Inflammation factor 20; Inflammation factor protein 20; TIPE2; TNF alpha-induced protein 8-like protein 2; TNFAIP8-like protein 2; TNFAIP8L2; TP8L2_HUMAN; Tumor necrosis factor alpha induced protein 8 like 2; Tumor necrosis factor alpha-induced protein 8-like protein 2
Target Background
Predicted to be involved in negative regulation of T cell activation and negative regulation of inflammatory response. Predicted to be active in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
