Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNS4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-520 of human TNS4 (NP_116254.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNS4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-520 of human TNS4 (NP_116254.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01118A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNS4 |
| Target Synonyms | CTEN; PP14434; TNS4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, HepG2, MCF7, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-520 of human TNS4 (NP_116254.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CPEPGSSPPQRTPGHQNSVQPGAASPSNPCPATRSNSQTLSDAPFTTCPEGPARDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRGSFGLALKVQEVPASAQSRPGEDSNDLIRHFLIESSAKGV | Uniprot ID | Q8IZW8 |
Uniprot Id
Q8IZW8
Target Species
Human
Target Name
TNS4
Target Full Name
Tensin-4
Target Function
May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton. May promote apoptosis, via its cleavage by caspase-3.
Target Subcellular Location
Cell junction, focal adhesion. Cytoplasm, cytoskeleton.
Target Tissue Specificity
Prostate and placenta. Down regulated in prostate cancer.
Target Synonyms
C terminal tensin like; C terminal tensin like protein; C-terminal tensin-like protein; CTEN; FLJ14950; PP14434; TENS4_HUMAN; Tensin 4; Tensin-4; Tns4
Target Background
Predicted to enable actin binding activity. Involved in protein localization. Located in focal adhesion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
