-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOPBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOPBP1 (NP_008958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TOPBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOPBP1 (NP_008958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06323A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOPBP1 |
| Target Synonyms | Dpb11; TOP2BP1; TOPBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOPBP1 (NP_008958.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSRNDKEPFFVKFLKSSDNSKCFFKALESIKEFQSEEYLQIITEEEALKIKENDRSLYICDPFSGVVFDHLKKLGCRIVGPQVVIFCMHHQRCVPRAEHP | Uniprot ID | Q92547 |
Uniprot Id
Q92547
Target Species
Human
Target Name
TOPBP1
Target Full Name
DNA topoisomerase 2-binding protein 1
Target Function
Required for DNA replication. Plays a role in the rescue of stalled replication forks and checkpoint control. Binds double-stranded DNA breaks and nicks as well as single-stranded DNA. Recruits the SWI/SNF chromatin remodeling complex to E2F1-responsive promoters. Down-regulates E2F1 activity and inhibits E2F1-dependent apoptosis during G1/S transition and after DNA damage. Induces a large increase in the kinase activity of ATR.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Chromosome.
Target Tissue Specificity
Highly expressed in heart, brain, placenta, lung and kidney.
Target Synonyms
DNA topoisomerase 2 binding protein 1; DNA topoisomerase 2-binding protein 1; DNA topoisomerase II binding protein 1; DNA topoisomerase II binding protein; DNA topoisomerase II-beta-binding protein 1; DNA topoisomerase II-binding protein 1; DNA topoisomerase IIbeta binding protein 1; Hypothetical protein KIAA0259 [Fragment]; KIAA0259; TOP2BP1; TOPB1_HUMAN; TOPBP 1; TopBP1; Topoisomerase (DNA) II binding protein 1; Topoisomerase II binding protein 1
Target Background
This gene encodes a binding protein which interacts with the C-terminal region of topoisomerase II beta. This interaction suggests a supportive role for this protein in the catalytic reactions of topoisomerase II beta through transient breakages of DNA strands.
Notification