Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPM2 (NP_003280.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against TPM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPM2 (NP_003280.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-04183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPM2 |
| Target Synonyms | DA1; DA2B; NEM4; TMSB; AMCD1; DA2B4; HEL-S-273; TPM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse lung, Mouse skeletal muscle, SW620, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPM2 (NP_003280.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELD | Uniprot ID | P07951 |
Uniprot Id
P07951
Target Species
Human
Target Name
TPM2
Target Full Name
Tropomyosin beta chain
Target Function
Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. The non-muscle isoform may have a role in agonist-mediated receptor internalization.
Target Involvement
Nemaline myopathy 4 (NEM4); Arthrogryposis, distal, 1A (DA1A); Cap myopathy 2 (CAPM2); Arthrogryposis, distal, 2B (DA2B)
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Tropomyosin family
Target Tissue Specificity
Present in primary breast cancer tissue, absent from normal breast tissue.
Target Research Area
Signal Transduction
Target Synonyms
Alpha tropomyosin; AMCD1; Arthrogryposis multiplex congenital distal type 1; Beta tropomyosin; Beta-tropomyosin; Cytoskeletal tropomyosin TM30; DA1; DA2B; epididymis secretory protein Li 273; FLJ41118; Heat stable cytoskeletal protein 30 kDa; HEL-S-273; hscp30; HTM alpha; hTM5; MGC14582; MGC3261; MGC72094; NEM1; NEM4; Nemaline myopathy type 4; OK/SW cl.5; Sarcomeric tropomyosin kappa; TM 5; TM3; TM30; TM30nm; TMSA; TMSB; TPM 1; TPM 3; TPM1 alpha; TPM1 kappa; TPM2; TPM2_HUMAN; TRK; Tropomyosin 1 alpha; Tropomyosin 1 alpha chain; Tropomyosin 1 alpha chain isoform 6; Tropomyosin 2 (beta); Tropomyosin 2; Tropomyosin 3; Tropomyosin alpha 3 chain; Tropomyosin alpha striated muscle isoform; Tropomyosin beta chain; Tropomyosin gamma; Tropomyosin skeletal muscle beta; Tropomyosin-2
Target Background
This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
