-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TRAF5 (NP_665702.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRAF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TRAF5 (NP_665702.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09870A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAF5 |
| Target Synonyms | RNF84; MGC:39780; TRAF5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | OVCAR3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TRAF5 (NP_665702.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPI | Uniprot ID | O00463 |
Uniprot Id
O00463
Target Species
Human
Target Name
TRAF5
Target Full Name
TNF receptor-associated factor 5
Target Function
Adapter protein and signal transducer that links members of the tumor necrosis factor receptor family to different signaling pathways by association with the receptor cytoplasmic domain and kinases. Mediates activation of NF-kappa-B and probably JNK. Seems to be involved in apoptosis. Plays a role in mediating activation of NF-kappa-B by EIF2AK2/PKR.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytosol.
Target Protein Families
TNF receptor-associated factor family, A subfamily
Target Tissue Specificity
Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and peripheral blood.
Target Research Area
Immunology
Target Synonyms
MGC:39780 ; RING finger protein 84; RNF 84; RNF84; TNF receptor associated factor 5; TNF receptor-associated factor 5; TRAF 5; Traf5; TRAF5_HUMAN
Target Background
The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification