-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRDMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 192-391 of human TRDMT1 (NP_004403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRDMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 192-391 of human TRDMT1 (NP_004403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10929A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRDMT1 |
| Target Synonyms | DMNT2; DNMT2; PUMET; RNMT1; MHSAIIP; TRDMT1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, DU145, NCI-H460, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 192-391 of human TRDMT1 (NP_004403.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEKITVKQRYRLLGNSLNVHVVAKLIKILYE | Uniprot ID | O14717 |
Uniprot Id
O14717
Target Species
Human
Target Name
TRDMT1
Target Full Name
tRNA (cytosine(38)-C(5))-methyltransferase
Target Function
Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family
Target Tissue Specificity
Ubiquitous. Higher expression in testis, ovary and thymus and at much lower levels in spleen, prostate, colon, small intestine, and peripheral blood leukocytes.
Target Synonyms
dDNMT; DmMT 2; DmMT2; DNA (cytosine 5 ) methyltransferase 2; DNA (cytosine 5) methyltransferase like protein 2; DNA (cytosine-5)-methyltransferase-like protein 2; DNA 5 cytosine methyltransferase; DNA methyltransferase 2; DNA methyltransferase homolog HsaIIP; DNA MTase homolog HsaIIP; Dnmt 2; Dnmt2; M.HsaIIP; MHsaIIP; nmt 2; nmt2; OTTHUMP00000045198; PuMet; RNMT 1; RNMT1; TRDMT 1; TRDMT_HUMAN; TRDMT1; tRNA (cytosine 5 ) methyltransferase; tRNA (cytosine(38)-C(5))-methyltransferase; tRNA aspartic acid methyltransferase 1; tRNA aspartic acid methyltransferase 1 variant 1; tRNA aspartic acid methyltransferase 1 variant 2; tRNA aspartic acid methyltransferase 1 variant 3; tRNA aspartic acid methyltransferase 1 variant 4; tRNA aspartic acid methyltransferase 1 variant 5; tRNA aspartic acid methyltransferase 1 variant 8
Target Background
This gene encodes a protein responsible for the methylation of aspartic acid transfer RNA, specifically at the cytosine-38 residue in the anticodon loop. This enzyme also possesses residual DNA-(cytosine-C5) methyltransferase activity. While similar in sequence and structure to DNA cytosine methyltransferases, this gene is distinct and highly conserved in its function among taxa.
Notification