-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIB2 (NP_067675.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIB2 (NP_067675.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09209A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIB2 |
| Target Synonyms | C5FW; TRB2; GS3955; TRIB2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, K-562, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIB2 (NP_067675.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEII | Uniprot ID | Q92519 |
Uniprot Id
Q92519
Target Species
Human
Target Name
TRIB2
Target Full Name
Tribbles homolog 2
Target Function
Interacts with MAPK kinases and regulates activation of MAP kinases. Does not display kinase activity.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, Tribbles subfamily
Target Tissue Specificity
Highly expressed in peripheral blood leukocytes.
Target Synonyms
C5FW; FLJ57420; GS3955; Hypothetical protein TRB2; TRB-2; TRB2; TRIB 2; TRIB2; TRIB2_HUMAN; Tribbles homolog 2
Target Background
This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene.
Notification